PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 344aa    MW: 37732.1 Da    PI: 6.4167
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34185.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v+ +G+g+W++++++ g++R++k+c++rw +yl
       KHN34185.1 14 RGLWTPEEDAKILAYVANHGTGNWTLVPKKAGLKRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding44.43.9e-1470110446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T++E+el+++++   G++ W+ Ia++++ gRt++++k++w++
       KHN34185.1  70 FTPQEEELIINLHGAIGSR-WSIIAKRLP-GRTDNDVKNYWNT 110
                      9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.839965IPR017930Myb domain
SuperFamilySSF466895.5E-3011108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002496.8E-171461IPR001005SANT/Myb domain
CDDcd001676.39E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2365116IPR009057Homeodomain-like
SMARTSM007175.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129417.15266116IPR017930Myb domain
CDDcd001671.35E-1070112No hitNo description
PfamPF002499.8E-1370110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVA NHGTGNWTLV PKKAGLKRCG KSCRLRWTNY  60
LRPDLKHDGF TPQEEELIIN LHGAIGSRWS IIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDLGSIS GLPNTTTNQI AFINKDLMSN MLPITKTEPS GSNNSTVEHT  180
QEGQVPSWEH HIPYQVIINS ENIQSHVLSE AASSTSSSSS SNITQLGSPQ SYSCQTPQAQ  240
IAPPCSNFDW SEFLQSDSFN WSLNPSSGII QSEAELSNNA KSNGNDMQGD ASEGSGSGAV  300
ACGASMEYQI NKQCEAHSFV DGILDRNSEI RAAFPELLDA SFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014627228.10.0PREDICTED: transcription factor MYB35-like
SwissprotQ9LSI73e-86MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A0B2RLZ10.0A0A0B2RLZ1_GLYSO; Transcription factor MYB86
STRINGGLYMA19G02090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-85MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]